PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G30810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 572aa    MW: 62316.8 Da    PI: 8.5855
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G30810.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR413.7e-13110148241
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                      +kk CnCk+skClk+YCeCfa+g++C+  C+C++C+N+ +
  OPUNC01G30810.1 110 KKKCCNCKHSKCLKLYCECFASGVYCDG-CNCSNCFNNVK 148
                      799*************************.********987 PP

2TCR512.9e-16194233140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  OPUNC01G30810.1 194 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 233
                      589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-14109149IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.889110234IPR005172CRC domain
PfamPF036381.5E-9111146IPR005172CRC domain
SMARTSM011148.4E-20194235IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12197232IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MAAAAAAVSR ALQPRAVPVG FPQPQQLRAH LPVGVPQQLH PRGLPVMRSH HVVHVPLPRP  60
AVAVAVPVPQ VRPAQPQPVP RPPVAVPLKP ESPKPPRARL YDGKDGTPTK KKCCNCKHSK  120
CLKLYCECFA SGVYCDGCNC SNCFNNVKNE TARREAIDAT LERNPDAFRP KIGSSPHANR  180
NNMEVAGDLP LVGKHNKGCH CKKSGCLKKY CECFQANILC SENCKCMDCK NFEGSEERKA  240
LFQGDHKNSI HMQQAANAAV NGAIGAAAFS SPSTSRKRKH IDPSLDHSAK ENGAHRTSHV  300
PQKNGMPSDG PLPINQPVHP PTLGPFKVTY RPLLADIVQP GDVKELCKLL VVVSGNAAKA  360
YAGKKAQEDK VVEKEDEIRG KREGEMGGSL ASTNHDREEN NEDPNNQKAS ADDPSTGGTH  420
AGKASLEESK HDCNDDQKSN RPMSPGTLAL MCDEQDTMFM TSQNVVPQQA APVNQNQSEL  480
YAEQERCVLT EFRDCLHKLV TFGRMKEEKF SMAIKSEVPA HPMQANGVSR IPYSKEVDVP  540
VVKTFLQTSS RHPAAENSAT GHLDKKPKHE NT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1221120.0AK122112.1 Oryza sativa Japonica Group cDNA clone:J033127O09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621699.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD11e-150TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0E0JP040.0A0A0E0JP04_ORYPU; Uncharacterized protein
STRINGBGIOSGA000780-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-125Tesmin/TSO1-like CXC domain-containing protein